PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA000090-PA
Common NameOsI_05244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 507aa    MW: 51673.9 Da    PI: 8.1864
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA000090-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022298.5e-712784364154
            DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                       g+a+CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaa+rrerqq + +ass+ a+++a+aask++r l  ++q+++s+t++s+a++
  BGIOSGA000090-PA 278 GAATCQDCGNQAKKDCGHQRCRTCCKSRGFDCSTHVKSTWVPAARRRERQQLTGSASSSPATASAAAASKKPRLL--TSQTTTSHTSTSNATT 368
                       6789*********************************************************************87..88999999******** PP

            DUF702  97 kkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       +++++t+s          lP++v+++avfrcvrv+s+ddge+e+aYq++v+i+GhvfkG+LydqG+++
  BGIOSGA000090-PA 369 PRSFDTTSshqdasfresLPRQVRAPAVFRCVRVTSIDDGEDEYAYQATVTINGHVFKGFLYDQGVDD 436
                       *****99999*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-63279435IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.0E-26281323IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.5E-29387434IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAVSSSTLQL ARSHSVTPNA GAPLSAWAAS VAAQSAADTA RIRQRAVKLE RSISDLRGEE  60
KGYGKANGNR EVLSFVRVGM REFYIDTDVA AKSADISVAS GRRFPSDTGA FADWVASSAA  120
AAAAGRGDDL SLGFNATAAA AAPSGASLAA GLWGPASSSR QAALNYGMAD VGMVVVTPAA  180
SFHHTHHHHH HHEAAAAAAA AAAAAADPIF PLLSAGPCVL DPDKSAASGS AIQFWQPPPQ  240
LPSSAAGGNP NPSSSAFPYL KKPLPMLDTG GGSSGSGGAA TCQDCGNQAK KDCGHQRCRT  300
CCKSRGFDCS THVKSTWVPA ARRRERQQLT GSASSSPATA SAAAASKKPR LLTSQTTTSH  360
TSTSNATTPR SFDTTSSHQD ASFRESLPRQ VRAPAVFRCV RVTSIDDGED EYAYQATVTI  420
NGHVFKGFLY DQGVDDGRGL AATSNDDSTA GGVPNISELH LGGASISGNA MREGGSSMVH  480
SDLYGGGGGS GGGPHILGGS SYGNTMN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.93550.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329876530.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1024440.0AK102444.1 Oryza sativa Japonica Group cDNA clone:J033093N15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622050.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
TrEMBLB8A9L50.0B8A9L5_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA000090-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35793679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-59Lateral root primordium (LRP) protein-related